Sermorelin

Sermorelin is a synthetic 29-amino-acid peptide corresponding to the N-terminal segment of naturally occurring human growth hormone-releasing hormone (GHRH), also known as growth hormone-releasing factor (GRF).

The peptide is identified as GHRH (1–29)-NH₂ and has the sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR. Its defined structure makes Sermorelin a useful reference compound for controlled laboratory research involving peptide characterization, receptor interactions, molecular signaling, and GHRH-related biochemical pathways.

This Sermorelin product is supplied as research material for laboratory, biochemical, and analytical applications.

Product Details

• Compound: Sermorelin
• Also known as: GHRH (1–29)-NH₂ / GRF (1–29)-NH₂
• CAS Number: 86168-78-7
• Classification: Synthetic peptide / GHRH fragment
• Peptide length: 29 amino acids
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR
• Molecular formula: C149H246N44O42S
• Molecular weight: Approximately 3,357.9 g/mol
• Form: Research peptide
• Intended use: Laboratory and analytical research